DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Ret

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_033076.2 Gene:Ret / 19713 MGIID:97902 Length:1115 Species:Mus musculus


Alignment Length:304 Identity:131/304 - (43%)
Similarity:197/304 - (64%) Gaps:12/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 RWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMK 526
            :|||||..|.....||||.||:|.:..|..:.|..|.||||||.|||:|::.:.:|||||..::|
Mouse   717 KWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASQSELRDLLSEFNLLK 781

  Fly   527 SLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSR----------AERHYGN-THGKSN 580
            .:. |.:|:.|.|.|:...|..:|:||...|.|:.:||.||          ..|:..: .|....
Mouse   782 QVN-HPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSSLDHPDER 845

  Fly   581 VLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKS 645
            |||..||.||.:|:::||.||....::||||||||||:.:....|::|||.:|||.....|.:||
Mouse   846 VLTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKKS 910

  Fly   646 EGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVRDGYRLEKPE 710
            :|::|::|||.|||:|:|::.:||:||||:|:|||||||..|||||....:...::.|:|:|:|:
Mouse   911 KGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPD 975

  Fly   711 HCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLLHTEMDYIEL 754
            :|..|:|.:|..||..:|.:||:||:|.:.|:|::....||::|
Mouse   976 NCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDL 1019

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 121/281 (43%)
PTKc 474..742 CDD:270623 120/278 (43%)
RetNP_033076.2 Cadherin 173..262 CDD:278457
PTKc_RET 724..1013 CDD:173631 123/289 (43%)
Pkinase_Tyr 725..1006 CDD:285015 121/281 (43%)
Inhibitors binding. /evidence=ECO:0000250 806..808 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.