DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and old-1

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_496130.2 Gene:old-1 / 191737 WormBaseID:WBGene00003862 Length:502 Species:Caenorhabditis elegans


Alignment Length:300 Identity:99/300 - (33%)
Similarity:161/300 - (53%) Gaps:21/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 LGEGAFGQV----WRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMKSLEPHINVVH 536
            ||.|.||.:    .|.:.:.....|....||||.......::.::.:..||:||.::..|.|::.
 Worm   181 LGSGEFGIIRKGFLRSKNSKNEEKESRLEVAVKLPLNEYNQIQQELIYDELKVMCAVGKHPNILA 245

  Fly   537 LLGCCTDKDPTFVILEYVNRGKLQTYLRSSRAERHYGN----THGKSNVLTSCDLTSFMYQVAKG 597
            |:|..|..:...::.|:|..|.|.::||.:|.  ::.|    ...:.:.|:..||.||.:|:|||
 Worm   246 LVGGITFGERKMIVSEFVENGDLLSFLRDNRI--YFTNDQWTLETEQDSLSLVDLLSFAFQIAKG 308

  Fly   598 MDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKS-EGKLPIRWMATESLYD 661
            |:||.....:|||||.||:||..:...::||||.||.......|:.:| :..|||.|||.||:..
 Worm   309 MEYLIHVPCVHRDLALRNVLIKKNRIIRIADFGLARRHKNKDYYKTQSVDTPLPIHWMAPESIDK 373

  Fly   662 NIFSVKSDIWSFGILMWEIVTLGSTPYPGISAAD--------VMRKVRDGYRLEKPEHCRRELYN 718
            .:|:.|||:||:|:.::|:.:||.:||..:...|        |:..:.:|.||.:|.|...|:||
 Worm   374 LLFTQKSDVWSYGVCLYELFSLGKSPYENVIKYDQRDFYWKYVLSYLNEGKRLAQPAHADAEIYN 438

  Fly   719 IMYYCWSHDPQERPLFAEIIQMLDKLLHTEMD--YIELER 756
            :|..||..|...|..|.:.|:..:|.|.|..:  :::|.|
 Worm   439 VMKLCWDLDMNSRTTFLDCIEFFEKELKTTSNEYFLDLTR 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 94/281 (33%)
PTKc 474..742 CDD:270623 94/282 (33%)
old-1NP_496130.2 TyrKc 175..461 CDD:197581 94/281 (33%)
PTKc 179..462 CDD:270623 94/282 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.