DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and zig-13

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_497161.1 Gene:zig-13 / 188571 WormBaseID:WBGene00020546 Length:352 Species:Caenorhabditis elegans


Alignment Length:121 Identity:26/121 - (21%)
Similarity:40/121 - (33%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 CLTGGAGS--------SGAPENAFAGEANCDRWEFPRYRLKFFNILGEGAFGQV-----WRCEAT 490
            |.|.|.|.        :..|..||.......|::...|.....|:........:     ||.|.:
 Worm   107 CWTRGQGHPSFKHIHVADGPSKAFYNVGGAPRFQKSVYEQDTVNLFCAIPHSAINWKVSWRLENS 171

  Fly   491 N----------INGNEGITTVAVKTLKESAT-----EVDR-KDLLSELEVMKSLEP 530
            |          |:||.......||.:.:|..     |.|: |:....||.:..::|
 Worm   172 NSTSDLSVTTLIDGNSKYHVTTVKNITKSGVYTCVIEADKFKERRQLLETVIKVKP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 17/82 (21%)
PTKc 474..742 CDD:270623 17/78 (22%)
zig-13NP_497161.1 IG_like 251..301 CDD:214653
Ig 251..289 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.