DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and F59F5.3

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_509765.2 Gene:F59F5.3 / 186634 WormBaseID:WBGene00010342 Length:681 Species:Caenorhabditis elegans


Alignment Length:317 Identity:78/317 - (24%)
Similarity:136/317 - (42%) Gaps:68/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 RCEATNINGNEGI-------TTVAVKT-----LKESATEVDRKDLLSELEVMKSLEPHINVVHLL 538
            |.|..|.....|:       |....||     :|||   |.:.....||:::|||: |.|::..|
 Worm   360 RIEELNNKSKLGVGNSSTIYTAEICKTKKCIVIKES---VRKSHCTKELKLLKSLK-HPNIITPL 420

  Fly   539 G---------CCTDKDPTFVILEYVNRGKLQTYLRSSRAERHYGNTHGKSN-------VLTSCDL 587
            |         |...:....::|.|..:..|:||:......:..||....:|       .:|..||
 Worm   421 GVIVQPEQKTCFNVQIRQHLLLPYYQKTCLETYIHKFYPPKRGGNNIFHTNEATVPEEEITMFDL 485

  Fly   588 TSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSK----------IYE 642
            .|..:|||..::||....|.|||:|.||:||:::..||:.||..|:...|::          |.:
 Worm   486 VSIAWQVASALEYLKGMEITHRDVAMRNVLISNNKVCKITDFERAKKGETTRKISIEKKIKEILK 550

  Fly   643 RKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTP------YPGISAADVMRKVR 701
            ......:|..: ..|.|....:...|:::.||.||..:.:. ..|      ||.|          
 Worm   551 AHMSKDIPKEY-PNECLKGVYYYYSSEVYCFGRLMLCLFSF-MKPCDYGRIYPPI---------- 603

  Fly   702 DGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL-HTEMD-YIELER 756
                  :||:|.:.:|:::..|.:.:.:.||..:....:|..:| |.:.| :::|::
 Worm   604 ------QPENCPKAIYDLIVDCINENRKSRPSISSCKDVLSTVLKHMDHDEFLKLKQ 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 73/298 (24%)
PTKc 474..742 CDD:270623 73/299 (24%)
F59F5.3NP_509765.2 Pkinase_Tyr <413..637 CDD:369480 57/241 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.