DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and kin-30

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_506771.3 Gene:kin-30 / 180032 WormBaseID:WBGene00002211 Length:458 Species:Caenorhabditis elegans


Alignment Length:320 Identity:99/320 - (30%)
Similarity:164/320 - (51%) Gaps:28/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 GEGAFGQVWRCEATNINGNEGITT---VAVKTLKESATEVDRKDLLSELEVMKSLEPHINVVHLL 538
            |:|.||:|.:.....||...|...   ||||...:|..:...|.:|.|:::|.::..|.||:.::
 Worm   140 GQGNFGKVNKALLKLINQKTGEVVRMDVAVKKPADSTDKSQDKLILDEIKLMCAIGKHPNVLAIV 204

  Fly   539 GCCT------DKDPTFVILEYVNRGKLQTYLRSSRAERH--------YGNTHGKSNV---LTSCD 586
            |..|      .::...|:.|:|..|.|::.|:.:....|        .|.....|::   |::.|
 Worm   205 GAITKQEKVIGREHNLVVTEFVEGGDLRSVLKYTPYTFHDELTSTDRTGGQMVNSDIFDELSTSD 269

  Fly   587 LTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYER---KSEGK 648
            |.||.||:|.||:||.::..:|||||.||:.:..:...::.|||.||. .:.|.|.|   ..:..
 Worm   270 LYSFAYQIANGMEYLAAKPCVHRDLALRNVFVKRNKMIRIGDFGLARH-HSKKSYYRMQCNPDTP 333

  Fly   649 LPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGI---SAADVMRKVRDGYRLEKPE 710
            |||.|:|.|...::.|:..:|:||:|:.::|:.:||.:||..:   .:.||:..::.||||..|.
 Worm   334 LPIFWLAPECFNESKFTEMTDVWSYGVCLFELFSLGESPYKKLHNSPSYDVVHYLKKGYRLSAPR 398

  Fly   711 HCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL-HTEMDYIELERFPDHNYYNIVSLS 769
            :|..|:|..|.|||:.|...||.|.|.......|: ..::..||.....:....|.:||:
 Worm   399 YCNAEIYEFMLYCWNIDATLRPKFTECKDFCKSLITRKKLKKIESRLQMEEQLQNELSLA 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 93/289 (32%)
PTKc 474..742 CDD:270623 93/290 (32%)
kin-30NP_506771.3 TyrKc 134..428 CDD:197581 93/288 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.