DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and ver-1

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_497162.2 Gene:ver-1 / 175182 WormBaseID:WBGene00006894 Length:1083 Species:Caenorhabditis elegans


Alignment Length:301 Identity:94/301 - (31%)
Similarity:160/301 - (53%) Gaps:38/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 WEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGI-----TTVAVKTLKESATEVDRKDLLSEL 522
            :||.:..|:....:|.|.||.|.|          ||     |.||||:....::...:|.::.||
 Worm   796 FEFHKDSLEILEPIGSGHFGVVRR----------GILKGTKTVVAVKSSSYRSSIGFQKVIVEEL 850

  Fly   523 EVMKSLEPHINVVHLLGCCTDK---DPTFVILEYVNRGKLQTYLRSSR---AERHYGN------- 574
            ::|.::..|.||:.|:|..|..   ...::::||::.|.|:.:|:..|   .:..:.|       
 Worm   851 KLMSAIPKHPNVLALVGAITKNLRHGELYILMEYIDGGNLRDFLQQRRNVFIDELHDNFDENIPL 915

  Fly   575 THGKSNVLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSK 639
            .....|.|::.||....:|:|.||::|.:...:|.:|..|.:||:...|.::.|:|...      
 Worm   916 IRPDFNSLSTTDLVGIAHQIANGMEWLGNVPCVHGNLCCRKVLISKTKTIRITDYGVGD------ 974

  Fly   640 IYERKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVRDGY 704
             .:|||..   :||||.|::...:||.|||:|||||.::||.|||.||||.....::::.:::|.
 Worm   975 -RQRKSSS---MRWMAPEAIEHQMFSSKSDVWSFGICLYEIFTLGGTPYPTCVTENILKHIKNGS 1035

  Fly   705 RLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL 745
            |..:||:|...||::|..||...||:||.|:...::::|.|
 Worm  1036 RNLQPEYCPSALYDLMQLCWRAPPQDRPKFSLCSELIEKQL 1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 90/288 (31%)
PTKc 474..742 CDD:270623 89/285 (31%)
ver-1NP_497162.2 Ig <294..331 CDD:299845
ig 576..652 CDD:278476
IG_like 578..654 CDD:214653
IG_like 660..731 CDD:214653
IGc2 674..722 CDD:197706
Pkinase_Tyr 803..1072 CDD:285015 90/288 (31%)
PTKc 807..1073 CDD:270623 89/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.