DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and kin-15

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_741035.2 Gene:kin-15 / 174498 WormBaseID:WBGene00002199 Length:488 Species:Caenorhabditis elegans


Alignment Length:324 Identity:94/324 - (29%)
Similarity:163/324 - (50%) Gaps:42/324 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 RWEFPRYRLKFF-NILGEGAFGQV------WRCEATNINGNEGITTVAVKTLKESATEVDRKDLL 519
            |:|..:.:|:.. :.||.|.||:|      .|...|..:..:.: :||||...:...|...|.:.
 Worm   135 RFEIDQAKLEISEDKLGSGFFGEVCYGLLSMRTSNTETDTLQKL-SVAVKQSNDPTQENQEKMIE 198

  Fly   520 SELEVMKSLEPHINVVHLLGCCTDKDPT---FVILEYVNRGKLQTYLRSSRA------------- 568
            .|.::|.::..:.|::.::|..|....:   .:|:|:|..|.|..:|...::             
 Worm   199 DETKLMCAIGRNPNILAIIGAVTANSGSARNLLIVEFVECGDLLKFLEEKKSIFKDELVYEKNGY 263

  Fly   569 -------ERHYGNTHGKSNV-------LTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILIT 619
                   .:.|.....:.:|       |.:.||.||.||:|:||:||.|...:|||||.||:|:.
 Worm   264 LLPKSIRRKTYMFNENEDDVIEESLDSLCTSDLLSFSYQIAEGMEYLASIPCVHRDLALRNVLLN 328

  Fly   620 DDHTCKVADFGFARDVITSKIYERKSEG---KLPIRWMATESLYDNIFSVKSDIWSFGILMWEIV 681
            .:.|.::||||.||.......| |.::|   .:|.||||.|.:.:...:.|||:||:|:.::|:.
 Worm   329 KNKTIRIADFGLARKYQVDGYY-RITKGVGTPMPARWMAPEVMREGKCTEKSDVWSYGVSLYEMF 392

  Fly   682 TLGSTPYPGISAADVMRKVRDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL 745
            :||..||..:|.:||...|..|.:|..|::|..::|:.|...|:.|...||.|::.::..::.|
 Worm   393 SLGELPYSNVSNSDVFEHVVQGNQLPMPQYCHPKMYDRMKQFWNFDATFRPSFSKCVEFFEEHL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 91/310 (29%)
PTKc 474..742 CDD:270623 90/306 (29%)
kin-15NP_741035.2 STYKc 147..452 CDD:214568 90/306 (29%)
PTKc 148..453 CDD:270623 90/306 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.