DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Kit

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001116205.1 Gene:Kit / 16590 MGIID:96677 Length:979 Species:Mus musculus


Alignment Length:369 Identity:131/369 - (35%)
Similarity:191/369 - (51%) Gaps:72/369 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 RWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMK 526
            :|||||.||.|...||.||||:|....|..:..::...|||||.||.||...:|:.|:|||:|:.
Mouse   584 KWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLS 648

  Fly   527 SLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSRAERHYGNTHGKS------NVL--- 582
            .|..|:|:|:|||.||...||.||.||...|.|..:||..|....:.....::      |:|   
Mouse   649 YLGNHMNIVNLLGACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQAEAALYKNLLHST 713

  Fly   583 -TSC----------------------------------------------------DLTSFMYQV 594
             .||                                                    ||.||.|||
Mouse   714 EPSCDSSNEYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLDDLLSFSYQV 778

  Fly   595 AKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLPIRWMATESL 659
            ||||.:|.|:..|||||||||||:|.....|:.|||.|||:.....|..|...:||::|||.||:
Mouse   779 AKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPESI 843

  Fly   660 YDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISA-ADVMRKVRDGYRLEKPEHCRRELYNIMYYC 723
            :..:::.:||:||:||.:||:.:|||:||||:.. :...:.:::|:|:..|||...|:|::|..|
Mouse   844 FSCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMVSPEHAPAEMYDVMKTC 908

  Fly   724 WSHDPQERPLFAEIIQMLDKLLHTEMDYIELERFPDHNYYNIVS 767
            |..||.:||.|.:::|:::|         ::.....|.|.|:.:
Mouse   909 WDADPLKRPTFKQVVQLIEK---------QISDSTKHIYSNLAN 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 121/333 (36%)
PTKc 474..742 CDD:270623 119/330 (36%)
KitNP_001116205.1 ig 217..308 CDD:278476
IG_like 221..310 CDD:214653
Ig4_SCFR 314..414 CDD:143268
IG_like 325..412 CDD:214653
Ig 427..501 CDD:299845
PTKc_Kit 556..930 CDD:270682 128/354 (36%)
Important for interaction with phosphotyrosine-binding proteins. /evidence=ECO:0000250 571..573
Pkinase_Tyr 592..926 CDD:285015 121/333 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.