DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad96Ca and Flt3

DIOPT Version :9

Sequence 1:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster
Sequence 2:NP_001094292.1 Gene:Flt3 / 140635 RGDID:61308 Length:1000 Species:Rattus norvegicus


Alignment Length:344 Identity:127/344 - (36%)
Similarity:183/344 - (53%) Gaps:64/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 RWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMK 526
            :|||||..|:|..:||.||||:|....|..|:.......||||.|||.|...:|:.|::||::|.
  Rat   602 KWEFPRENLEFGKVLGSGAFGRVMNATAYGISKTGVSIQVAVKMLKEKADRCEREALMAELKMMT 666

  Fly   527 SLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSRAERH-------------------- 571
            .|..|.|:|:|||.||...|.::|.||...|.|..||||.|.:.|                    
  Rat   667 HLGHHDNIVNLLGACTLSGPVYLIFEYCCHGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQS 731

  Fly   572 ------------------------YGNT-HGKS------------------NVLTSCDLTSFMYQ 593
                                    .||: |.:.                  ||||..||..|.||
  Rat   732 HSNSSMPGSREVQIYPPVDQVSGFNGNSIHSEGNIEYENQKRLEEEEEEDLNVLTFEDLLCFAYQ 796

  Fly   594 VAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLPIRWMATES 658
            |||||::|..:..:||||||||:|:|.....|:.|||.|||:::...|..:...:||::|||.||
  Rat   797 VAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDILSDSSYVVRGNARLPVKWMAPES 861

  Fly   659 LYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISA-ADVMRKVRDGYRLEKPEHCRRELYNIMYY 722
            |::.|:::|||:||:|||:|||.:||..|||||.. |:..:.::.|:::|:|.:...|:|.:|..
  Rat   862 LFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQSGFKMEQPFYATEEIYFVMQS 926

  Fly   723 CWSHDPQERPLFAEIIQML 741
            ||:.|.::||.|..:...|
  Rat   927 CWAFDSRKRPSFPNLTSFL 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 121/334 (36%)
PTKc 474..742 CDD:270623 120/332 (36%)
Flt3NP_001094292.1 ig 255..345 CDD:278476
PKc_like 572..949 CDD:304357 127/344 (37%)
Pkinase_Tyr 610..945 CDD:285015 121/334 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.