DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dan and Y48G1C.6

DIOPT Version :10

Sequence 1:NP_001262948.1 Gene:dan / 43023 FlyBaseID:FBgn0039286 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_490670.1 Gene:Y48G1C.6 / 171597 WormBaseID:WBGene00021679 Length:223 Species:Caenorhabditis elegans


Alignment Length:262 Identity:47/262 - (17%)
Similarity:84/262 - (32%) Gaps:96/262 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 SVRSLSSNEQNPEADEATETDLDGEVEPEASGKPEDLSAAGKVMTPSQSPIAHSSGSRSPEPKAK 515
            :.:.|:.|.||.:...|.:.:::.::|...|...:.||..|:       |:.:..          
 Worm    38 AAKDLNVNRQNIQQWIAQKAEIEKQLEDNGSTATKRLSGGGR-------PLKYDD---------- 85

  Fly   516 TKTPETTNSTSECKKILDNMLFKMGGMEATGPLMPEQGSSESEGS---FQDTSNPHTNNNDVSAS 577
                            :|..|.|.         :.:|...:...:   ..:|:...:.|:|..||
 Worm    86 ----------------VDKELIKW---------VHDQRKEKQRVTRRIIGETAKKISQNSDFKAS 125

  Fly   578 NNNNNNNSNKTDEEEKAKYLD---CTADEDIEAIRHGEKFLQWLENCSNPRVTAV--QLMQ--LR 635
            ..                :||   |         ||         |.|..|....  .|||  :.
 Worm   126 RG----------------WLDKFMC---------RH---------NLSTRRARTEPGDLMQTLVD 156

  Fly   636 FLIAAIKS--GNETPMIE--KSALPEDSEEHAAEEEGSGRGKSRRRKXEKPKLAPTEPATDTEIE 696
            .|:....|  |.|.|||.  ||.:|      :.|:...|..::.....:.||:...|...:::.:
 Worm   157 ILLRQTSSDDGEEDPMISFIKSCIP------SGEDPLEGEDQAASSSVQVPKVLAEENGHESDSD 215

  Fly   697 DS 698
            .|
 Worm   216 QS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
danNP_001262948.1 CENP-B_N 10..62 CDD:461229
Y48G1C.6NP_490670.1 HTH_28 21..79 CDD:463908 9/40 (23%)
CENPB 80..142 CDD:197828 17/130 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.