DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dan and tigd5

DIOPT Version :9

Sequence 1:NP_001262948.1 Gene:dan / 43023 FlyBaseID:FBgn0039286 Length:781 Species:Drosophila melanogaster
Sequence 2:XP_012820589.1 Gene:tigd5 / 100491467 XenbaseID:XB-GENE-6257697 Length:536 Species:Xenopus tropicalis


Alignment Length:309 Identity:75/309 - (24%)
Similarity:118/309 - (38%) Gaps:113/309 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RDKIHAIQRIHDGESKASVARDIGVPESTLRGWCKNEDKLRFMSRQSATDNLCADALGDKMDGGG 83
            :||:.||:|:.:||.:|||:||.|||..|||||.|:|.|||:.     .|.|             
 Frog    13 KDKLEAIERVKNGERQASVSRDFGVPGGTLRGWLKDEQKLRWF-----LDQL------------- 59

  Fly    84 GGGGGAGGGGLLGPPEKRQRL------DGA------------LPLN----------FSNKLKFDE 120
                    ||.:|...|:.||      |.|            :||:          |:.::..||
 Frog    60 --------GGDVGTHRKKMRLANEEEIDRAVYSWFISLRQQGIPLSGPIIQAQAEAFAKQIYGDE 116

  Fly   121 LAFKRSPLNGLDYSTNKNLADLGYNGLPVDYAAFNGGVKAKVFG-ADINRPAADPSLNAISPLSS 184
            ..||.|  :|..:...|.                :|....:::| :::.:...||.:  |.|...
 Frog   117 CTFKAS--HGWFWRWQKR----------------HGISSQRIYGESEVRQTEMDPVI--IFPEQP 161

  Fly   185 LT------------HLSGLTGISQSPLAISFNELTTNLNLLAQLNPG-----------LAA-MSG 225
            .|            :.:.:||:....|....:::     :||:...|           ||| ::|
 Frog   162 NTPVADSGYGDEQIYNANITGLYWKLLPDQTHDM-----ILAKQPDGYKHIKERVTVLLAANLTG 221

  Fly   226 LNSF-PAGAGNLRTPKPSGQTPLQVQSPRSDSGDRSAQGLSVKNWAKQK 273
            .:.. |...|.||.| ||.:...|.:.|......|:|       |..|:
 Frog   222 SHKLKPLVVGKLRDP-PSLRHHNQDKFPAVYHYSRNA-------WVTQE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
danNP_001262948.1 CENP-B_N 10..62 CDD:282122 25/42 (60%)
tigd5XP_012820589.1 HTH 7..56 CDD:304362 25/47 (53%)
HTH_Tnp_Tc5 76..136 CDD:281246 13/77 (17%)
rve 208..387 CDD:304425 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10159
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.