DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clbn and Ermn

DIOPT Version :9

Sequence 1:NP_001163721.1 Gene:Clbn / 43018 FlyBaseID:FBgn0259152 Length:992 Species:Drosophila melanogaster
Sequence 2:NP_001008312.1 Gene:Ermn / 295619 RGDID:1308367 Length:282 Species:Rattus norvegicus


Alignment Length:199 Identity:43/199 - (21%)
Similarity:76/199 - (38%) Gaps:67/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 RSLEDDQI-DPNVKEN-EVEHDLLSDNEDADSNINLSEPSSNTEITAFPNTEVKIEHDTGRIIVR 735
            |..||::| :.|.:|| .|.|..:.|       ::|.|.|:  |.|.|..     .|...:|.:.
  Rat    70 RGSEDEKILNENTEENLFVVHQAIQD-------LSLQETSA--EDTVFQE-----GHPWKKIPLN 120

  Fly   736 SDSVNPEIEETKESEVVLDKILKKTDDEE-----TTIILAGPSRKKQVSAKKTK----------- 784
            |.:    ::.:::.|.::.:.|::.:||.     |.|...|..:..||....:|           
  Rat   121 SHN----LDMSRQKERIVHQHLEQREDESAAHQATEIEWLGFQKSSQVDILHSKCDEEEEVWNEE 181

  Fly   785 --------------EDKARA-------------KQEAAKQEVPPVSSEPKNP----SQVKRGQKG 818
                          ||:.|.             |:|:..:|..|:||....|    .|:..|:||
  Rat   182 INEEDVDECAEDEGEDEVRVIEFKRKYREGSPLKEESLAREDSPLSSPSSQPGTPDEQLVLGKKG 246

  Fly   819 KLKK 822
            .:.:
  Rat   247 DIAR 250

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ClbnNP_001163721.1 YloA 1..643 CDD:224212
DUF814 531..630 CDD:283353
DUF3441 883..984 CDD:288752