DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs2B and NRK1

DIOPT Version :9

Sequence 1:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_014270.1 Gene:NRK1 / 855594 SGDID:S000005073 Length:240 Species:Saccharomyces cerevisiae


Alignment Length:121 Identity:30/121 - (24%)
Similarity:45/121 - (37%) Gaps:18/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KKVLSLAYEAYDSMALKEMNKICSDLRSKWLDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEAL 106
            |||:.:|.....|.....:.|:.:.|.:|...:.....|.....|||.....:....||   |||
Yeast     4 KKVILVALSGCSSSGKTTIAKLTASLFTKATLIHEDDFYKHDNEVPVDAKYNIQNWDSP---EAL 65

  Fly   107 ESVSFA--IDQLKTRVPIWKKEIYDGDNDSE----------WKENK---ESIRPKK 147
            :...|.  :|.:|....|..|.|::.:.|..          |.|.|   :||...|
Yeast    66 DFKLFGKELDVIKQTGKIATKLIHNNNVDDPFTKFHIDRQVWDELKAKYDSINDDK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 24/106 (23%)
NRK1NP_014270.1 NRK1 8..198 CDD:238982 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.