DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs2B and MBIP

DIOPT Version :9

Sequence 1:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_057670.2 Gene:MBIP / 51562 HGNCID:20427 Length:344 Species:Homo sapiens


Alignment Length:313 Identity:85/313 - (27%)
Similarity:140/313 - (44%) Gaps:54/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LDLKHIVI-----YHRLGTVPVCEASVVIAASSPH-----------RSEALESVSFAIDQLKTRV 120
            |||:..|:     :::|.::...:.:::.:|...|           :|...|..:.|::::....
Human    44 LDLRDDVVKITIDWNKLQSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTE 108

  Fly   121 PIWKKEIYD----GDNDSEWKENKESIRP-KKSKSGFNYAACPCKVEESHDVPRTLVQIRVNDAE 180
            ...|.|:.|    ||...|.|..:..:|. ||::..|:              |. :|||:...||
Human   109 MGNKNEVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFD--------------PE-VVQIKAGKAE 158

  Fly   181 LTKRLECFVNRKRDEINSQNVIDFKSSFVSSDQNLSDSCARTQSTIIKQEQSNCHLKVRRVNNRC 245
            :.:|:..|:.||:.|||..||.:|.:..   |.|..:|||||.:..........|:||.||.|..
Human   159 IDRRISAFIERKQAEINENNVREFCNVI---DCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTY 220

  Fly   246 GPQQMEMRPNYELELNKLMGSRDGQTDPTKEMRKSLPNSRLQAIESYMGLTTDN--EENIFSRIK 308
            |||   .||      ..:.||........::........|||.||:::.|.|..  ..:|:.|||
Human   221 GPQ---TRP------EGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIK 276

  Fly   309 RVENRLLQLESISPEYRHFTKREPSSMEAAPPKKSRKKSYSAQELSAFIQKIK 361
            ::|:::|:||.|||||...........:..||    :::||..||...|..:|
Human   277 KLEDKILELEGISPEYFQSVSFSGKRRKVQPP----QQNYSLAELDEKISALK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 16/84 (19%)
MBIPNP_057670.2 Interaction with MAP3K12 172..344 54/170 (32%)
Leucine-zipper 1. /evidence=ECO:0000255 271..285 6/13 (46%)
Leucine-zipper 2. /evidence=ECO:0000255 314..329 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7908
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.