DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs2B and MOCS2

DIOPT Version :9

Sequence 1:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_004522.1 Gene:MOCS2 / 4338 HGNCID:7193 Length:188 Species:Homo sapiens


Alignment Length:140 Identity:79/140 - (56%)
Similarity:102/140 - (72%) Gaps:3/140 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMNKICSD 66
            |.:....:.:.:..:.||:....|||.|:||||||:||:||||:||.||||..||..|:.|||||
Human    45 DVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSD 109

  Fly    67 LRSKWLDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKEIYDGD 131
            :|.|| .:|||.::||||.|||.|||::||.||.||:.:||:||:|||.||.:|||||||||  :
Human   110 IRQKW-PVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIY--E 171

  Fly   132 NDSEWKENKE 141
            ..|.||.|||
Human   172 ESSTWKGNKE 181

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 73/125 (58%)
MOCS2NP_004522.1 MoaE 54..177 CDD:238385 73/125 (58%)