DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs2B and Mbip

DIOPT Version :9

Sequence 1:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_038968430.1 Gene:Mbip / 362740 RGDID:1306310 Length:349 Species:Rattus norvegicus


Alignment Length:345 Identity:85/345 - (24%)
Similarity:140/345 - (40%) Gaps:90/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ICSDLRS-----KWLDLKHIVI-----YHRLGTVPVCEASVVIAASSPH---------------- 101
            :|...||     ..|:|:..|:     ::||.::...:.::::.|...|                
  Rat    30 LCEVFRSLHTLTGQLNLRDDVVKITIDWNRLQSLSTSQPALLLTALEQHVLYLQMSLCSFQPFLA 94

  Fly   102 -----------RSEALESVSFAIDQLKTRVPIWKKEIYDGDNDSEWKENKESIRPKKSKSGFNYA 155
                       .:|..::.:....:|:.::|       .||...|.|                  
  Rat    95 KLQSLIKENSTAAELRQTEAETKSELRAKLP-------TGDLQDEGK------------------ 134

  Fly   156 ACPCKVEESHDVPRT-------LVQIRVNDAELTKRLECFVNRKRDEINSQNVIDFKSSFVSSDQ 213
               .|.::..||.:|       :|||:...||:.:|:..|:.||:.|||..||.:|.:..   |.
  Rat   135 ---LKDDDLGDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVI---DC 193

  Fly   214 NLSDSCARTQSTIIKQEQSNCHLKVRRVNNRCGPQQMEMRPNYELELNKLMGSRDGQTDPTKEMR 278
            |..:|||||.:..........|:||.||.|..|||   .||      ..:.||....|...::..
  Rat   194 NQENSCARTDAVFTPYPGFKSHVKVSRVVNTYGPQ---TRP------EGIAGSGHKPTGMLRDCG 249

  Fly   279 KSLPNSRLQAIESYMGLTTDN--EENIFSRIKRVENRLLQLESISPEYRHFTKREPSSMEAAPPK 341
            ......|||.||:::.|.|..  ..:|:.|||::|:::|:||.|||||...........:..|| 
  Rat   250 NQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVNFSGKRRKVQPP- 313

  Fly   342 KSRKKSYSAQELSAFIQKIK 361
               :::||..||...|..:|
  Rat   314 ---QQNYSLAELDEKISALK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 16/110 (15%)
MbipXP_038968430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7574
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5017
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.