DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs2B and Mbip

DIOPT Version :9

Sequence 1:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_663417.1 Gene:Mbip / 217588 MGIID:1918320 Length:341 Species:Mus musculus


Alignment Length:328 Identity:89/328 - (27%)
Similarity:141/328 - (42%) Gaps:63/328 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ICSDLRS-----KWLDLKHIVI-----YHRLGTVPVCEASVVIAASSPH---RSEALESVSFAID 114
            :|...||     :.|:|:..|:     ::||.::...:.::::.|...|   ....|..:...:.
Mouse    30 LCEVFRSLHTLTRQLNLRDDVVKITIDWNRLQSLSASQPALLLTALEQHVLYLQPFLAKLQSLMK 94

  Fly   115 QLKTRVPIWKKEIYDGDNDSEWKENKESIRPK-------KSKSGFNYAACPCKVEESHDVPRT-- 170
            :..|...|.:.|       :|.|....:|.|.       |.|.        |.|   .||.:|  
Mouse    95 ENSTATEIRQTE-------AETKSELRAIHPTEDLQDEGKPKD--------CDV---GDVKKTQN 141

  Fly   171 -----LVQIRVNDAELTKRLECFVNRKRDEINSQNVIDFKSSFVSSDQNLSDSCARTQSTIIKQE 230
                 :|||:...||:.:|:..|:.||:.|||..||.:|.:..   |.|..:|||||.:......
Mouse   142 LFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVI---DCNQENSCARTDAVFTPYP 203

  Fly   231 QSNCHLKVRRVNNRCGPQQMEMRPNYELELNKLMGSRDGQTDPTKEMRKSLPNSRLQAIESYMGL 295
            ....|:||.||.|..|||   .||      ..:.||....|...::........|||.||:::.|
Mouse   204 GFKSHVKVSRVVNTYGPQ---TRP------EGIAGSGHKPTGMLRDCGNQAVEERLQNIEAHLRL 259

  Fly   296 TTDN--EENIFSRIKRVENRLLQLESISPEYRHFTKREPSSMEAAPPKKSRKKSYSAQELSAFIQ 358
            .|..  ..:|:.|||::|:::|:||.|||||...........:..||    :::||..||...|.
Mouse   260 QTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVNFSGKRRKVQPP----QQNYSLAELDEKIS 320

  Fly   359 KIK 361
            .:|
Mouse   321 ALK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 15/86 (17%)
MbipNP_663417.1 Interaction with MAP3K12 170..341 55/170 (32%)
Leucine-zipper 1. /evidence=ECO:0000255 269..283 6/13 (46%)
Leucine-zipper 2. /evidence=ECO:0000255 312..327 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7729
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5091
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.