DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs2B and LOC103911725

DIOPT Version :9

Sequence 1:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_017213495.2 Gene:LOC103911725 / 103911725 -ID:- Length:159 Species:Danio rerio


Alignment Length:153 Identity:77/153 - (50%)
Similarity:102/153 - (66%) Gaps:7/153 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DHVKLVNDPIDIAHIHQLLADEGCGASSVFVGTTRDNFQGKKVLSLAYEAYDSMALKEMNKICSD 66
            |.:.|..|.:....:.:.:....|||.|:|:|||||||:||||:.|.||||..||..::.||||.
Zfish     8 DLITLTTDKLFADRVSESVTCPSCGAVSLFIGTTRDNFEGKKVVRLEYEAYAPMAESKLKKICSH 72

  Fly    67 LRSKWLDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKEIYDGD 131
            :|:||..::||.|.||||.|.|.||||:|..||||||::||::.:.||.||..|||||||||: .
Zfish    73 IRTKWPSVRHINIQHRLGLVSVTEASVIIGISSPHRSDSLEALKYCIDTLKATVPIWKKEIYE-S 136

  Fly   132 NDSEWKENKESI------RPKKS 148
            .:..||||||.:      .||:|
Zfish   137 GEPCWKENKECLWADGGKHPKES 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 65/125 (52%)
LOC103911725XP_017213495.2 PLN02390 29..138 CDD:178014 65/109 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5735
eggNOG 1 0.900 - - E1_COG0314
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005690
OrthoInspector 1 1.000 - - oto41345
orthoMCL 1 0.900 - - OOG6_101652
Panther 1 1.100 - - LDO PTHR23404
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R840
SonicParanoid 1 1.000 - - X5369
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.