DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mocs2B and mbip

DIOPT Version :9

Sequence 1:NP_651340.1 Gene:Mocs2B / 43017 FlyBaseID:FBgn0039280 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001107965.1 Gene:mbip / 100038057 XenbaseID:XB-GENE-478230 Length:330 Species:Xenopus tropicalis


Alignment Length:338 Identity:85/338 - (25%)
Similarity:144/338 - (42%) Gaps:72/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AYEAYDSMALKEMNKICSDLRSKWLDLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFA 112
            :||......|..:.:....|:.....::..|.:..|..:|..:..::.:....|.|:    :...
 Frog    21 SYEELLRGTLLALQRCTQQLKVTESSVRFDVDWGNLQCLPDAKPVLLCSLLQQHISD----IQPL 81

  Fly   113 IDQLKTRVPIWKKEIYDGDNDSEWKENKESIRPKKSKSGFNYA--ACPCKV----------EESH 165
            :|:|:..|   .:|:...||.:           |..:||...|  |...||          :.|.
 Frog    82 MDKLQALV---YEEVQPNDNSA-----------KTEESGLEKADLATAGKVMPESNPGESLQTSD 132

  Fly   166 DVPRTLVQIRVNDAELTKRLECFVNRKRDEINSQNVIDFKSSFVSSDQNLSDSCARTQSTIIKQE 230
            ....::|||:...:|:.:|:..|:.||:.|||..||.:|.:..   |.|..:|||||.:......
 Frog   133 GFDPSVVQIKAKKSEIDRRILAFIERKQAEINENNVREFCNVI---DCNQENSCARTDAVFTPYP 194

  Fly   231 QSNCHLKVRRVNNRCGPQQMEMRPNYELELNKLMGSRDGQT-------DPTK-EMRKSLPNSRLQ 287
            ....|:||.||.|..|||                 :|:..|       :|.: :........|||
 Frog   195 GFKSHIKVSRVVNTYGPQ-----------------TRNDNTAAPRLRANPVQLDCGNQAVEERLQ 242

  Fly   288 AIESYMGLTTDN--EENIFSRIKRVENRLLQLESISPEYRHFTKREPSSMEAAPPKKS--RKKSY 348
            .||.::.|....  .::::.|||.:|:::|:||.|||||.|       |::.:..:|:  ..:||
 Frog   243 NIECHLRLQRSGPVPKDVYQRIKSLEDKILELEGISPEYFH-------SLDVSKKRKALQTSESY 300

  Fly   349 SAQELSAFIQKIK 361
            |..|:.   ||||
 Frog   301 SLAEID---QKIK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mocs2BNP_651340.1 MoaE 11..137 CDD:238385 15/88 (17%)
mbipNP_001107965.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.