DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vig2 and SERBP1

DIOPT Version :10

Sequence 1:NP_733083.1 Gene:vig2 / 43016 FlyBaseID:FBgn0046214 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001018077.1 Gene:SERBP1 / 26135 HGNCID:17860 Length:408 Species:Homo sapiens


Alignment Length:56 Identity:15/56 - (26%)
Similarity:20/56 - (35%) Gaps:16/56 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RRRRATLKYRTA-HATRERIRVEAFNVAFSELRKLLPTLPPDKKLSKIEILKLAIC 131
            ||:..||..|.| |..|.......|.:.||               |..::..:|||
Human    34 RRQLKTLAQRLARHPGRGCAESCDFLIYFS---------------SSGDVACMAIC 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vig2NP_733083.1 HABP4_PAI-RBP1 175..273 CDD:461421
PRK11634 <339..406 CDD:236941
SERBP1NP_001018077.1 IHABP4_N 5..151 CDD:465041 15/56 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..292 15/56 (27%)
HABP4_PAI-RBP1 189..313 CDD:461421
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..408
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.