| Sequence 1: | NP_733083.1 | Gene: | vig2 / 43016 | FlyBaseID: | FBgn0046214 | Length: | 443 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018077.1 | Gene: | SERBP1 / 26135 | HGNCID: | 17860 | Length: | 408 | Species: | Homo sapiens |
| Alignment Length: | 56 | Identity: | 15/56 - (26%) |
|---|---|---|---|
| Similarity: | 20/56 - (35%) | Gaps: | 16/56 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 77 RRRRATLKYRTA-HATRERIRVEAFNVAFSELRKLLPTLPPDKKLSKIEILKLAIC 131 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| vig2 | NP_733083.1 | HABP4_PAI-RBP1 | 175..273 | CDD:461421 | |
| PRK11634 | <339..406 | CDD:236941 | |||
| SERBP1 | NP_001018077.1 | IHABP4_N | 5..151 | CDD:465041 | 15/56 (27%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 33..292 | 15/56 (27%) | |||
| HABP4_PAI-RBP1 | 189..313 | CDD:461421 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 328..408 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||