DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl16 and CG32762

DIOPT Version :9

Sequence 1:NP_001097912.1 Gene:Nepl16 / 43014 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster


Alignment Length:143 Identity:28/143 - (19%)
Similarity:49/143 - (34%) Gaps:45/143 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 TAPSPLPRDCYMDGDRC---SPAV---SAPPECS--DPICEAVASSIQARLNW------------ 173
            |.....||:|.:....|   ||.|   :|..||.  :.||..:.:::..:...            
  Fly    33 TTARTTPRNCPLFPQVCSQTSPRVCGRTARGECQRFENICHLMLANVLRQPEGVRHTRDIDCRNV 97

  Fly   174 ------NKDPC---TEFKKFSCWRNTPNKNITNLIEMGNSQKSVDSQMLYLFQNKIMNGSFGILH 229
                  |:.||   ...:...|.|:.|::.|        ..:|.|::...:..|...      |.
  Fly    98 RGTGAANRRPCYNPCPARPVVCKRSPPSQQI--------CVRSRDNRQCKVLANSCQ------LR 148

  Fly   230 NLFESCLQQTTNS 242
            |  ::|..|..|:
  Fly   149 N--QNCHSQPRNN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 14/70 (20%)
CG32762NP_001284894.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.