powered by:
Protein Alignment Nepl16 and F41C6.4
DIOPT Version :9
Sequence 1: | NP_001097912.1 |
Gene: | Nepl16 / 43014 |
FlyBaseID: | FBgn0039277 |
Length: | 752 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001129930.1 |
Gene: | F41C6.4 / 185599 |
WormBaseID: | WBGene00018278 |
Length: | 393 |
Species: | Caenorhabditis elegans |
Alignment Length: | 80 |
Identity: | 12/80 - (15%) |
Similarity: | 25/80 - (31%) |
Gaps: | 28/80 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 LNWNKDPCTEFKKFSC----------------------------WRNTPNKNITNLIEMGNSQKS 207
::.:.|||.:|.:.:| |.|...:...|.|:.|..:..
Worm 29 IDQSSDPCDDFYRHACPVGDYDFLVLMKYAPIFKELETSQEESAWENLKIEEALNNIKPGEIENE 93
Fly 208 VDSQMLYLFQNKIMN 222
:.:....:|.:...|
Worm 94 ISAYFERVFLDMCQN 108
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Nepl16 | NP_001097912.1 |
GluZincin |
176..749 |
CDD:301352 |
12/75 (16%) |
F41C6.4 | NP_001129930.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11733 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.