DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FKH2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_014331.3 Gene:FKH2 / 855656 SGDID:S000005012 Length:862 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:71/273 - (26%)
Similarity:110/273 - (40%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||:||.::...||:.||:.::.|::||::|...:.:||.....||||:|||||.|..|.||||.
Yeast   340 KPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRR 404

  Fly    78 VTKAGKGSYWTLHPMAFDMFEN------------GSLLRRR-----KRFRVKQLEKDIS-NWKLA 124
            ..:.|||..|.:.......|.|            ||.:.|:     .:|....:|.|.. :..:|
Yeast   405 PNEPGKGMKWRISESYQQEFLNKWNTGKVGKIRRGSSVARQLQLHMAKFNSLPMEMDYRLSLNMA 469

  Fly   125 AAANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLP----ARPK 185
            .....::.:|.:.:...........:|.....|..|:|.|    .||:.....:|.|    .|.:
Yeast   470 QPPKRQLQSHNVLEPSNNNIIEGFVQHVPSKGNLPASQQS----QPPVSHQNQSQQPPPQEQRQE 530

  Fly   186 RAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNELAAQYQLYFPSFFYNGQY 250
            ..||.        |.|.|..           :||.: |...|          ||..|:...|...
Yeast   531 IQFTF--------ADTQNRN-----------IALAR-PIKTP----------QLQAPNSNANLNQ 565

  Fly   251 GNIPCYQKT--PP 261
            .|:..|:::  ||
Yeast   566 NNMKEYKESLHPP 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 36/99 (36%)
Alpha_kinase 106..>194 CDD:295997 17/97 (18%)
FKH2NP_014331.3 COG5025 1..610 CDD:227358 71/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.