DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and HCM1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_009991.2 Gene:HCM1 / 850429 SGDID:S000000661 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:316 Identity:82/316 - (25%)
Similarity:122/316 - (38%) Gaps:96/316 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            :||||||.:|..:||:.|.:..|.||:||.:|...||:|::....||||:|||||.||.|||..:
Yeast   108 KKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEK 172

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNW--------KLAAAANTEMVT 133
            :..  |||.:|.:.|.|...|..|.  .|...| ||...:||..:        :|....:.|...
Yeast   173 SCD--GKGHFWEVRPGAETKFFKGE--NRGYEF-VKDSLQDIGKYFEIDSTLDELEQVESGEGND 232

  Fly   134 HYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDP 198
            ...|::..:.|...|:.  .:..|:|           |||  .|:||...|:       |...:.
Yeast   233 DLPDEEEREEAGKFPSI--EIQLNSS-----------PIL--RVSQLHHIPQ-------LKTDNS 275

  Fly   199 ASTPNEGLVPM------EYGSPDAVALEKPPF--------------------------------- 224
            ...|:|.|..|      :..:.|::   :||:                                 
Yeast   276 VLNPHENLESMRNMIENDVNNIDSL---EPPYVMKKYHTSLGLPSLVNAKDHFQAGVKNNNITQA 337

  Fly   225 ----NLPFNFNELAAQYQLYFPSFFYNGQYGNIPCYQKTPPLFHN-------GPLP 269
                .||....:....::.||.||..|        ::...||..|       .|||
Yeast   338 NRFNTLPITSAKSPQNFRKYFTSFNSN--------FEDLSPLRSNVGAGSLLDPLP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 40/87 (46%)
Alpha_kinase 106..>194 CDD:295997 19/95 (20%)
HCM1NP_009991.2 COG5025 20..564 CDD:227358 82/316 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I1601
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.