DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxb1b

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_571358.2 Gene:foxb1b / 799571 ZFINID:ZDB-GENE-990415-77 Length:296 Species:Danio rerio


Alignment Length:241 Identity:109/241 - (45%)
Similarity:140/241 - (58%) Gaps:48/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            ||||.:.:|.||||||||||||||||...|:::|||||||:||||:||:||:|||:|||||||||
Zfish     1 MPRPGRNTYSDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130
            ||||||||:||...:.||||:|.|||...|||||||.|||||||:|.     ||:..|...::  
Zfish    66 SFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVM-----ISSEHLQKPSD-- 123

  Fly   131 MVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMA 195
             ..|||..|         |:...........||:.|.       .:||| |:..|..|.||:::|
Zfish   124 -AAHYLQQQ---------AKLRMTALGTHLPQMTSYN-------LSVTQ-PSTFKHPFAIENIIA 170

  Fly   196 PDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFN-FNELAAQYQLY 240
            .|                      .|.|.:|.|: .:.::..||::
Zfish   171 RD----------------------YKMPGSLAFSAMHSMSTGYQIH 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 65/87 (75%)
Alpha_kinase 106..>194 CDD:295997 24/87 (28%)
foxb1bNP_571358.2 FH 13..101 CDD:214627 65/87 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - mtm6425
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.