DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxj1a

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001070174.2 Gene:foxj1a / 767737 ZFINID:ZDB-GENE-060929-1178 Length:458 Species:Danio rerio


Alignment Length:199 Identity:61/199 - (30%)
Similarity:89/199 - (44%) Gaps:50/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            ||||||.:|..||:..|.:..:.||.||::|.|.|.::|.....||||:|||||.|.|||||||.
Zfish   142 KPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQ 206

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRR-----------KRFRV------------------KQ 113
            ..:.|||.:|.:.|...:...|.:..:||           .|.|:                  :|
Zfish   207 KDEPGKGGFWKIDPQYAERLLNEAYKKRRLPPVQINPALQHRLRMNAQATGVISRNLSVSPESQQ 271

  Fly   114 LEKDI-------SNW--KLAAAANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKAT 169
            |.||.       .||  :||.|.   |::.::..:.|... ..|..|        ....:|.:::
Zfish   272 LLKDFEEATSADQNWDPRLAEAT---MLSCWISGKGTNKR-KQPYNH--------RTGKTPRRSS 324

  Fly   170 PPIL 173
            .|:|
Zfish   325 SPLL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 41/87 (47%)
Alpha_kinase 106..>194 CDD:295997 19/106 (18%)
foxj1aNP_001070174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..99
Forkhead 142..228 CDD:278670 40/85 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..324 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.