Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070174.2 | Gene: | foxj1a / 767737 | ZFINID: | ZDB-GENE-060929-1178 | Length: | 458 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 61/199 - (30%) |
---|---|---|---|
Similarity: | 89/199 - (44%) | Gaps: | 50/199 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
Fly 78 VTKAGKGSYWTLHPMAFDMFENGSLLRRR-----------KRFRV------------------KQ 113
Fly 114 LEKDI-------SNW--KLAAAANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKAT 169
Fly 170 PPIL 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 41/87 (47%) |
Alpha_kinase | 106..>194 | CDD:295997 | 19/106 (18%) | ||
foxj1a | NP_001070174.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..99 | ||
Forkhead | 142..228 | CDD:278670 | 40/85 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..324 | 4/27 (15%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |