DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxk2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011247520.1 Gene:Foxk2 / 68837 MGIID:1916087 Length:690 Species:Mus musculus


Alignment Length:226 Identity:70/226 - (30%)
Similarity:98/226 - (43%) Gaps:46/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVP 75
            |.||||||..|...||..:|.:.|.|:.||..|...:|:||...:.||||:|||||.|..|||||
Mouse   286 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVP 350

  Fly    76 RNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR----FRVKQLEKDISNWKLAAAANTEMVTHYL 136
            |:..:.||||:|.:.|.:.......:..:||.|    ||..                       |
Mouse   351 RSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPCFRTP-----------------------L 392

  Fly   137 DDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLP-------ARPKRAFTIESLM 194
            ....::.|.|.|...|.:.|::|.||      ||..|....:..|       ::||.|...|:..
Mouse   393 GPLSSRSAPASPNHAGVLSAHSSGAQ------TPESLSREGSPAPLEPEPGASQPKLAVIQEARF 451

  Fly   195 APDPASTPNEG---LVPMEYGSPDAVALEKP 222
            |.....:|...   |:.::...|.|:   ||
Mouse   452 AQSAPGSPLSSQPVLITVQRQLPPAI---KP 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 40/87 (46%)
Alpha_kinase 106..>194 CDD:295997 21/98 (21%)
Foxk2XP_011247520.1 FHA 41..>124 CDD:238017
COG5025 <175..>381 CDD:227358 41/94 (44%)
Forkhead 287..373 CDD:365978 40/85 (47%)
PHA03247 <380..683 CDD:223021 29/132 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.