DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxl1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:294 Identity:108/294 - (36%)
Similarity:144/294 - (48%) Gaps:75/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            ||||||||:|.||||..:|::.:.|:.||:||||:||||..|.|.||||:|||||.|:||:||||
  Rat    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPR 112

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRR------------KRFRVKQLEK----DISNWKLAA 125
            ...:.||||||||.|...||||||:..||:            ||.||:..|.    |:.:..||.
  Rat   113 EKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEAKRTRVEPRESEVGCDVGSPNLAT 177

  Fly   126 AANTEMVTHYLDDQLTQMAFADPARH------GHVLANASA--------AQMSPYKATP---PI- 172
            |.     ..:..|:....|....||.      |..|.:..|        |..|.....|   |: 
  Rat   178 AR-----PMHEPDRSQSPAAGGTARSALLPWPGPELRDPDADRTIQDAGAVASGQLERPVHYPVH 237

  Fly   173 -LPTTVTQLPA-RPK----RAFTIESLMA--PDPA--------STPNEG-----LVPMEYGSPDA 216
             |.:::...|: .||    ::|:|:|::|  |.||        |.|..|     |:....|.|  
  Rat   238 HLGSSLRPAPSGSPKGSKSKSFSIDSILAVRPKPASGAEAPGISKPLPGALGSSLLTASSGLP-- 300

  Fly   217 VALEKPPFN--LPFN------FNELAAQYQLYFP 242
                 ||||  |.|:      |::|...:..|||
  Rat   301 -----PPFNASLVFDPHVQGGFSQLGIPFLSYFP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 56/87 (64%)
Alpha_kinase 106..>194 CDD:295997 27/127 (21%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.