DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxl3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_038945901.1 Gene:Foxl3 / 680273 RGDID:1594158 Length:216 Species:Rattus norvegicus


Alignment Length:202 Identity:72/202 - (35%)
Similarity:91/202 - (45%) Gaps:63/202 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|.||||:|.||||..||...:.||.||.|||.:||:||.|.:.||||:|||||.|.||:|||| 
  Rat    32 RPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPR- 95

  Fly    78 VTKA---GKGSYWTLH---PMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYL 136
             |:.   |||:|||..   ....|:||||:..|||:|...|..|                    .
  Rat    96 -TEGHDKGKGNYWTFAGGCESLLDLFENGNFRRRRRRRGPKSEE--------------------A 139

  Fly   137 DDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRA---------FTIES 192
            ...|...|...|...|                         ||.|.|..:|         |:|:.
  Rat   140 PGPLQPAARGSPGPDG-------------------------TQAPDREAQARLVTHRDIKFSIDY 179

  Fly   193 LM-APDP 198
            :: :|||
  Rat   180 ILSSPDP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 51/93 (55%)
Alpha_kinase 106..>194 CDD:295997 15/96 (16%)
Foxl3XP_038945901.1 Forkhead 32..115 CDD:395192 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.