DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXL2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:296 Identity:97/296 - (32%)
Similarity:120/296 - (40%) Gaps:91/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            |||||||::|.||||..|.::.|.||.||::|:.:||||.||.:.||||:|||||.|:|||||||
Human    53 QKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPR 117

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFR------------------------------- 110
            ......||:||||.|...||||.|:..|||:..|                               
Human   118 EGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAGAG 182

  Fly   111 ---------VKQLEKDISN--W--------------KLAAAANTEMVTHYLDDQLTQMAFADPAR 150
                     .|.|:....|  |              ::||||......         .|.|.|..
Human   183 ADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAA---------AAAAGPGS 238

  Fly   151 HGHV-----LANASAAQMSPY-----KATPPILPTTVTQL---PARP---------KRAFTIESL 193
            .|..     || ..||...||     .|.||.:..:...|   ||.|         ..|..:.:.
Human   239 PGAAAVVKGLA-GPAASYGPYTRVQSMALPPGVVNSYNGLGGPPAAPPPPPHPHPHPHAHHLHAA 302

  Fly   194 MAPDPASTPNEGLVPMEYG--SPDAVALEKPPFNLP 227
            .||.|| .|:.|......|  ||.:.|...||...|
Human   303 AAPPPA-PPHHGAAAPPPGQLSPASPATAAPPAPAP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 28/165 (17%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 97/296 (33%)
Forkhead 53..139 CDD:365978 51/85 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.