Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001078945.1 | Gene: | FOXD4L6 / 653404 | HGNCID: | 31986 | Length: | 417 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 84/235 - (35%) |
---|---|---|---|
Similarity: | 108/235 - (45%) | Gaps: | 69/235 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
Fly 78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
Fly 143 MAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEG-- 205
Fly 206 -----------------LVPMEYGSP---DAVALEKP-PF 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 49/87 (56%) |
Alpha_kinase | 106..>194 | CDD:295997 | 18/87 (21%) | ||
FOXD4L6 | NP_001078945.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 70..105 | ||||
Forkhead | 108..194 | CDD:278670 | 48/85 (56%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |