DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxq1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:301 Identity:82/301 - (27%)
Similarity:119/301 - (39%) Gaps:114/301 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|.||||..|....|.|:||..::|.:|||:|.:...|:||:|||||.||||:||.|:
  Rat   115 KPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRD 179

  Fly    78 VTKA-GKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLT 141
            .::. ||.:||.|:|.:...|.:|...|||||                       ::|       
  Rat   180 PSRPWGKDNYWMLNPNSEYTFADGVFRRRRKR-----------------------LSH------- 214

  Fly   142 QMAFADPARHGHVLANASAAQMSPYKA------TPPILPTT----VTQLPARPKR---------- 186
                         ....||:.:.|.:|      ||...||.    :.:.|||.:.          
  Rat   215 -------------RTTVSASGLRPEEAPPGPAGTPQPAPTAGSSPIARSPARQEEGSSPASKFSS 266

  Fly   187 AFTIESLMAP--------DPA-----------------------STPNEGLVPM-EYGSPD---- 215
            :|.|:|:::.        |||                       ::....|:|: .||:.:    
  Rat   267 SFAIDSILSKPFRSRRDGDPALGVQLPWSAAPCPPLRAYPALLPASSGGALLPLCAYGAGEPTLL 331

  Fly   216 ---------AVALEKPPFNL-----PFNFNELAAQYQLYFP 242
                     |..|...|.:.     ||...|.|....||.|
  Rat   332 ASRGAEVQPAAPLLLAPLSTAAPAKPFRGPETAGAAHLYCP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 44/88 (50%)
Alpha_kinase 106..>194 CDD:295997 18/107 (17%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 41/77 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.