DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxb1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_071773.2 Gene:Foxb1 / 64290 MGIID:1927549 Length:325 Species:Mus musculus


Alignment Length:300 Identity:117/300 - (39%)
Similarity:153/300 - (51%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            ||||.:.:|.||||||||||||||||..||:::|||||||:||||:||:||:|||:|||||||||
Mouse     1 MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130
            ||||||||:||...:.||||:|.|||...|||||||.|||||||:|  |:.|             
Mouse    66 SFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKV--LKSD------------- 115

  Fly   131 MVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMA 195
                       .:|.:.||.....|...:..::|       .|..:.|.||..|..|:.:..:..
Mouse   116 -----------HLAPSKPADAAQYLQQQAKLRLS-------ALAASGTHLPQMPAAAYNLGGVAQ 162

  Fly   196 PDPASTP--NEGLVPMEYGSPDAV---ALEKPP--FNLPFNFNELAAQYQLYFPSFFYNGQYGNI 253
            |.....|  .|.::..||..|..:   |::..|  :.||.....:.:.....:|..:  |..|.|
Mouse   163 PSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVY--GSAGMI 225

  Fly   254 PCYQKTP----------------PLFHNG-------PLPV 270
            .  ..||                ||.|..       |:|:
Mouse   226 D--SATPISMTSGDYSAYGVPLKPLCHAAGQTLPAIPVPI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 66/87 (76%)
Alpha_kinase 106..>194 CDD:295997 18/87 (21%)
Foxb1NP_071773.2 FH 13..101 CDD:214627 66/87 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849384
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - mtm8816
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.