DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxg1c

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:267 Identity:92/267 - (34%)
Similarity:126/267 - (47%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFN 68
            |.|.|..| |||:||.:|..|||..||:|.|.|:.||.|||..||:||:|.|.||||:|||||.|
Zfish    82 PEKKSKPD-KPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYRENRQGWQNSIRHNLSLN 145

  Fly    69 DCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSL--LRRRK--RFRVKQLEKDISNWKLAAAANT 129
            .||:||||:....|||:||.|.|.:.|:|..|:.  ||||.  ..|.|...|..:.....||:  
Zfish   146 KCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTAASRAKLAMKRGARLSSTAAS-- 208

  Fly   130 EMVTHYLDDQLTQMAFAD----------PARHGHVLANASAAQMSPYKATPPILPTTVTQLPARP 184
                       ..:|||.          ..:|.|  ::.:||..|.|.|:  :|..:.....:..
Zfish   209 -----------AGLAFAGSFYWPVPPFVTLQHRH--SSPAAAHHSNYAAS--VLSQSARHFSSVA 258

  Fly   185 KRAFTIESLMAPDPASTPNEGL-------VPMEYGSPDAVALEKPPFNLPFNFNELAAQYQLYFP 242
            ..|   |.|:.|........|:       ....:.:..:|.|   |.:.|.:||.|:.|     .
Zfish   259 PAA---ERLLIPSSQEATYYGMGCEQMTSSSSSFSTSASVPL---PLSAPCSFNLLSNQ-----S 312

  Fly   243 SFFYNGQ 249
            |:||:.|
Zfish   313 SYFYSHQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 19/99 (19%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.