DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxq2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001098411.1 Gene:foxq2 / 565796 ZFINID:ZDB-GENE-050208-663 Length:244 Species:Danio rerio


Alignment Length:104 Identity:48/104 - (46%)
Similarity:72/104 - (69%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVP 75
            |:||..|||:|.:|||:.|.::.|.|.:||::|||.:|:::...:.|:||:|||||.|:||||..
Zfish    85 DEKPAQSYIALISMAILDSDEKKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNECFIKAG 149

  Fly    76 RNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQL 114
            |  :..|||.:|.:||..|..|.||...|||.|.|::::
Zfish   150 R--SDNGKGHFWAIHPANFQDFSNGDYHRRRARRRIRRV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 41/87 (47%)
Alpha_kinase 106..>194 CDD:295997 3/9 (33%)
foxq2NP_001098411.1 Forkhead 87..171 CDD:278670 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.