DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxd4l1.1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001016928.1 Gene:foxd4l1.1 / 549682 XenbaseID:XB-GENE-479247 Length:352 Species:Xenopus tropicalis


Alignment Length:255 Identity:91/255 - (35%)
Similarity:118/255 - (46%) Gaps:72/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||.:.|.||.|..||..:||:|:.....||||:|||||.||||||:||.
 Frog    97 KPPYSYIALITMAILQSPHKKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPRE 161

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLE--KD----------------------I 118
            ....|||:||||.|.:.|||:|||.|||||||:..|.|  ||                      :
 Frog   162 PGNPGKGNYWTLDPASEDMFDNGSFLRRRKRFKRHQQEFFKDGLVMYNPLPYYRPYSTIQPQQVL 226

  Fly   119 SNWKLAAAA---NTEMVTHY--LDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVT 178
            ....:|..|   |..|.||.  ..|...::.:.|...|...  .|..|...|.|           
 Frog   227 QQTPVACMAIPENLTMPTHLSPYPDIKRKVPYPDQGVHRGF--EALDADNHPNK----------- 278

  Fly   179 QLPARPKRAFTIESLM----APDPA-STPNEGLVPMEYGSPDAVALEKPPFNLPFNFNEL 233
               ::.|.:|:||::|    .|:|: ||                      ||..:|:|.|
 Frog   279 ---SQSKCSFSIENIMRKPKEPEPSFST----------------------FNPHWNYNHL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 51/87 (59%)
Alpha_kinase 106..>194 CDD:295997 25/116 (22%)
foxd4l1.1NP_001016928.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..92
Forkhead 97..183 CDD:278670 50/85 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.