DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxo4

DIOPT Version :10

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_061259.1 Gene:Foxo4 / 54601 MGIID:1891915 Length:505 Species:Mus musculus


Alignment Length:104 Identity:37/104 - (35%)
Similarity:60/104 - (57%) Gaps:14/104 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYR-----KNTQKWQNSLRHNLSF 67
            ::|:|    ||..|.:.||..:|::.|.|::||.:::...|:::     .::..|:||:|||||.
Mouse   100 AWGNQ----SYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSL 160

  Fly    68 NDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRR 106
            :..||||....|  ||.|:|.|:|   |..:.|...|||
Mouse   161 HSKFIKVHNEAT--GKSSWWMLNP---DGGKGGKAPRRR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH_FOX 1..110 CDD:469596 37/104 (36%)
Foxo4NP_061259.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Required for interaction with FOXK1. /evidence=ECO:0000269|PubMed:22956541 97..215 37/104 (36%)
FH_FOXO4 98..183 CDD:410836 32/91 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..244 9/23 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..276
FOXO_KIX_bdg <359..399 CDD:465228
FOXO-TAD 466..503 CDD:435506
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.