DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxi3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:277 Identity:89/277 - (32%)
Similarity:123/277 - (44%) Gaps:79/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|||||.:|.||||..:|:|.|.||.||:|:.|.||||:::...||||:|||||.||||.||||:
  Rat   131 RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRD 195

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMV--THYLDDQL 140
            ....|||:||||.|....||:||:..|:|:|             :..|::|..:.  |...|.|.
  Rat   196 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRRR-------------RAEASSNLTVPSGTSKSDGQS 247

  Fly   141 TQMAFA----------------DPARHGHVLANASAAQMSPYKATPPI----------------- 172
            :::..:                .|.......:.||:...|...:||.:                 
  Rat   248 SRLRVSGKLEGDSPSSMLRPSQSPEPPEGTKSTASSPGASTLTSTPCLNTFLSSFNTLSVNASSM 312

  Fly   173 -----LPTT-----VTQLPARPKRAFTIESLMAPDPA------STPNEG------LVPMEYGSPD 215
                 ||.:     .||||:    :.|..|...||.:      ||...|      ..|...||.|
  Rat   313 STQRTLPGSRRHPGGTQLPS----STTFPSTSIPDSSLDSVQLSTVGGGSQLSSYYSPFSGGSGD 373

  Fly   216 AVALEKPPFNLPF-NFN 231
                :..||..|| ||:
  Rat   374 ----QSSPFGSPFYNFS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 51/87 (59%)
Alpha_kinase 106..>194 CDD:295997 21/132 (16%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.