DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxj1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:202 Identity:65/202 - (32%)
Similarity:94/202 - (46%) Gaps:32/202 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            ||||||.:|..||:..|.:..:.||.||::|.|.|.::|.....||||:|||||.|.|||||||.
 Frog   197 KPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRE 261

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRR-------KRFRVKQL-----EKDISNWKLAAAANTE 130
            ..:.|||.:|.:.|...|...||::.:||       ..|...|.     ....|.|:|:..:.:.
 Frog   262 KDEPGKGGFWKIDPQYADRLMNGAMKKRRLPPVQIHPAFASAQAAASGNSNRGSPWQLSVNSESH 326

  Fly   131 MVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMA 195
            .:....::...:..:.....||.   ||.:...| :|...|:           |||.|     .|
 Frog   327 QLLKEFEEATGEQGWNALGEHGW---NAISDGKS-HKRKQPL-----------PKRMF-----KA 371

  Fly   196 PDPASTP 202
            |..:|:|
 Frog   372 PRLSSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 42/87 (48%)
Alpha_kinase 106..>194 CDD:295997 17/99 (17%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 41/85 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.