DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxd1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:268 Identity:89/268 - (33%)
Similarity:114/268 - (42%) Gaps:99/268 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||::.|.||||..||.::||:||:....||||:|||||.||||:|:||.
 Frog    68 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 132

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||||.|.:.|||:|||.|||||||:                          ..|..:
 Frog   133 PGNPGKGNYWTLDPESADMFDNGSFLRRRKRFK--------------------------RQQAPE 171

  Fly   143 MAFADPARHGHVLANASAAQMSPY---------------------------KATPPILP------ 174
            :...:|   ||.|. |||....||                           :..||.||      
 Frog   172 LVLREP---GHFLP-ASAYSYGPYSCAYGIQLQPFHPHSALIAFQQQQQQARQQPPSLPPMAAPA 232

  Fly   175 ----------TTVTQLP------------------ARPKRAFTIESLMAPDPASTPNEGLVPMEY 211
                      .|.|..|                  |..:..|:|||::..|        |.|.:.
 Frog   233 LMPPAAQDLSRTCTFYPHQLSPAALPPSLQSKSSSALARSTFSIESIIGGD--------LNPGQC 289

  Fly   212 GSPDAVAL 219
            .||.|..:
 Frog   290 NSPKAAGV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 26/148 (18%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Forkhead 68..153 CDD:365978 50/84 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.