Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001008148.1 | Gene: | foxd1 / 493510 | XenbaseID: | XB-GENE-488077 | Length: | 329 | Species: | Xenopus tropicalis |
Alignment Length: | 268 | Identity: | 89/268 - (33%) |
---|---|---|---|
Similarity: | 114/268 - (42%) | Gaps: | 99/268 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
Fly 78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
Fly 143 MAFADPARHGHVLANASAAQMSPY---------------------------KATPPILP------ 174
Fly 175 ----------TTVTQLP------------------ARPKRAFTIESLMAPDPASTPNEGLVPMEY 211
Fly 212 GSPDAVAL 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 52/87 (60%) |
Alpha_kinase | 106..>194 | CDD:295997 | 26/148 (18%) | ||
foxd1 | NP_001008148.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..63 | ||
Forkhead | 68..153 | CDD:365978 | 50/84 (60%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |