DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and fkh

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster


Alignment Length:305 Identity:109/305 - (35%)
Similarity:147/305 - (48%) Gaps:64/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLS 66
            |...:.||...|||||||||..|||.::|.|:|.|||||:||||.|||||:|.|:||||:||:||
  Fly   199 PTTYRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLS 263

  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFR------VKQLEKDISNWKLAA 125
            |||||:|:||...|.||||:|||||.:.:|||||..|||:|||:      ::||.|..|:..|.|
  Fly   264 FNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKKEAIRQLHKSPSHSSLEA 328

  Fly   126 AA-------NTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPAR 183
            .:       ::..:.|:...:|      |..:|......||.|.::...|........:..|.| 
  Fly   329 TSPGKKDHEDSHHMHHHHHSRL------DHHQHHKEAGGASIAGVNVLSAAHSKDAEALAMLHA- 386

  Fly   184 PKRAFTIESLMAPDPASTP-----------NEGLVPM-----------EYGSPDAVALEKP---- 222
                 ..|..::..|...|           .|.|..|           :|.|......::|    
  Fly   387 -----NAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYT 446

  Fly   223 PFNLPFNFNEL-----AAQYQLYFPSFFYNGQYGNIPCYQKTPPL 262
            |.:.||:.|.|     .|..::|..|     ||..   |....||
  Fly   447 PSSHPFSINRLLPTESKADIKMYDMS-----QYAG---YNALSPL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 61/87 (70%)
Alpha_kinase 106..>194 CDD:295997 20/100 (20%)
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796 3/9 (33%)
FH 210..298 CDD:214627 61/87 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445514
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.