DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxc2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_998857.1 Gene:foxc2 / 407875 XenbaseID:XB-GENE-481382 Length:463 Species:Xenopus tropicalis


Alignment Length:318 Identity:104/318 - (32%)
Similarity:145/318 - (45%) Gaps:102/318 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||.::|.:.:.|:.||:||||:|||||:|.|.||||:|||||.|:||:||||:
 Frog    71 KPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRD 135

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQ--- 139
            ..|.||||||||.|.:::||||||.||||:||:    :||:|.         |.....|.||   
 Frog   136 DKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFK----KKDVSR---------EKEDRILKDQGKV 187

  Fly   140 ---------------------------LTQMAFADPARHGHVLANASAAQMSP--YKATPPILPT 175
                                       :|::....|       ...||.|.||  ..:||.:  :
 Frog   188 QGPIPSLELPKHDKKIVIKSESPELPVITKVENLSP-------DGGSAMQDSPRSVASTPSV--S 243

  Fly   176 TVTQLPAR--PKRAFTIESLM----------APDPASTPNEGLVPMEYGSPDAVALEKPPFNLPF 228
            |...:|.:  ....|::|::|          :|.||.....|:||                :||.
 Frog   244 TENSIPDQHPASNGFSVENIMTLRTSPHGDLSPVPAVPCRTGMVP----------------SLPI 292

  Fly   229 NFNELAAQY--QLYFPSFFYNGQY-----------GNIPCYQKTPPLF-------HNG 266
            |:.:..:..  |....|...:|.|           |:.|.:...|...       |||
 Frog   293 NYTQTQSSVYSQACTQSMDTSGSYQCSMRAMSLYTGDRPSHMCAPSTLEEATSDHHNG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 56/87 (64%)
Alpha_kinase 106..>194 CDD:295997 23/121 (19%)
foxc2NP_998857.1 Forkhead 71..156 CDD:306709 53/84 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.