DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxg1b

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:96 Identity:53/96 - (55%)
Similarity:68/96 - (70%) Gaps:2/96 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||:||.:|..|||..||::.|.|:.||.|||..||:||::.|.||||:|||||.|.||:||||:
Zfish    77 KPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRHNLSLNKCFVKVPRH 141

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSL--LRRR 106
            ....|||:||.|.|.:.|:|..|:.  ||||
Zfish   142 YDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 48/87 (55%)
Alpha_kinase 106..>194 CDD:295997 1/1 (100%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.