DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxa2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_989423.1 Gene:foxa2 / 395063 XenbaseID:XB-GENE-480476 Length:434 Species:Xenopus tropicalis


Alignment Length:266 Identity:98/266 - (36%)
Similarity:143/266 - (53%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLS 66
            |:..:.||...|||||||||..|||..||.::|.|||||::|||.|||||:|.|:||||:||:||
 Frog   138 PKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLS 202

  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRV-----------KQLEKDISN 120
            |||||:||||:..|.||||:|||||.:.:|||||..|||:|||:.           |:|.:..|:
 Frog   203 FNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKKPSLREGGGKKLSEGSSS 267

  Fly   121 WKLAAAANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPK 185
              :.:|||:.                         :.:|....||:.::.|......:.:..:..
 Frog   268 --VGSAANSS-------------------------SESSVGNESPHSSSSPCQEQKRSLVDMKSS 305

  Fly   186 RAFTIESLMAPDPASTP---NEGLVPMEYG--SPDAVALEKP----PFNLPFNFNELAAQYQLYF 241
            :.      ::||.|::|   .:.|:...:.  |.:|.:..||    .||.||:.|.|.:..|.:.
 Frog   306 QG------LSPDHAASPASQAQHLLSQHHSVLSHEAQSHLKPEHHYSFNHPFSINNLMSSEQQHH 364

  Fly   242 PSFFYN 247
            ....:|
 Frog   365 HHHHHN 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 61/87 (70%)
Alpha_kinase 106..>194 CDD:295997 13/98 (13%)
foxa2NP_989423.1 Forkhead_N 17..148 CDD:369872 3/9 (33%)
FH 149..237 CDD:214627 61/87 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..339 17/122 (14%)
HNF_C 349..423 CDD:370449 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.