DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxa1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_989419.1 Gene:foxa1 / 395059 XenbaseID:XB-GENE-487352 Length:428 Species:Xenopus tropicalis


Alignment Length:275 Identity:99/275 - (36%)
Similarity:140/275 - (50%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSF 67
            :..:.||...|||||||||..|||..:|.::|.|||||::|||.|.:||:|.|:||||:||:|||
 Frog   148 KTFRRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFLYYRQNQQRWQNSIRHSLSF 212

  Fly    68 NDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLE---------KDISNWKL 123
            ||||:||.|:..|.||||||||||.:.:|||||..|||:|||:.::.:         ||:|    
 Frog   213 NDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQQGGKGSQDGRKDVS---- 273

  Fly   124 AAAANTEMVTHYLDDQLTQM----AFADPARHGHVLA-NASAAQMSPYKATPPILPTTVTQLPAR 183
                ......|.:..:.:||    :.::|:.....|. |.|..:|.|..|..| .|.:..|..:.
 Frog   274 ----GPSSPLHRVHGKSSQMDSSSSMSNPSSSPQSLEHNGSNGEMKPQVAAGP-SPLSSHQNHST 333

  Fly   184 PKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNELAA----QYQLYFPSF 244
            ...|......:..||           .|.           ||.||:.|.|.:    |::|.|.::
 Frog   334 HSLAHETHIHLKGDP-----------HYS-----------FNHPFSINNLMSSSEQQHKLDFKAY 376

  Fly   245 -----FYNGQYGNIP 254
                 .|:...|.:|
 Frog   377 EQALQQYSSYSGGLP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 58/87 (67%)
Alpha_kinase 106..>194 CDD:295997 20/101 (20%)
foxa1NP_989419.1 Forkhead_N 17..157 CDD:369872 2/8 (25%)
FH 158..246 CDD:214627 58/87 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..337 16/88 (18%)
HNF_C 354..417 CDD:370449 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.