DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxi1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_988949.1 Gene:foxi1 / 394546 XenbaseID:XB-GENE-494125 Length:373 Species:Xenopus tropicalis


Alignment Length:273 Identity:86/273 - (31%)
Similarity:129/273 - (47%) Gaps:54/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|||||.:|.||||..:|.:.|.||:||:::.|.||||.|:...||||:|||||.||||.||||:
 Frog   123 RPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 187

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDIS-NWKLAAAANTEMVTHYLDDQLT 141
            ....|||:||||.|....||:||:..|:|||      :.|:| |.::::            |:..
 Frog   188 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR------KSDVSPNGQISS------------DKPE 234

  Fly   142 QMAFADPARHGH---VLANA------SAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAP- 196
            .....:..::|.   :|.|:      |:.:.||..:..|.|...::.:.|....|..: |...| 
 Frog   235 GSPLNESPKNGEHHDMLGNSSPGTDDSSEKRSPPPSITPCLNNFLSSMTAYVNSANPV-SRSVPL 298

  Fly   197 ----DPASTPNEGLV-----------PMEYGSPDAVALEKPPFNLPFN-FNELAAQYQLYFPSFF 245
                :|:....:.:|           |...||..:..:...||....: ||:        |...|
 Frog   299 GLTNEPSDRMGQNMVGLNSYTPLSNMPSHGGSDWSSTISSSPFGYSSSVFNQ--------FTPHF 355

  Fly   246 YNGQYGNIPCYQK 258
            ||....|...|.:
 Frog   356 YNTINANNTLYNR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 18/97 (19%)
foxi1NP_988949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Forkhead 123..208 CDD:365978 48/84 (57%)
COG5025 124..>308 CDD:227358 72/202 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..274 16/83 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.