DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxa4

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_988938.1 Gene:foxa4 / 394535 XenbaseID:XB-GENE-486455 Length:399 Species:Xenopus tropicalis


Alignment Length:275 Identity:98/275 - (35%)
Similarity:146/275 - (53%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLS 66
            ||..:.:|...|||||||||..|||..:|.:::.|:|||::|:|.||:||:|.|:||||:||:||
 Frog   108 PRTYRRNYSHAKPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLS 172

  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVK-----QLEKDISNWKLAAA 126
            |||||:||||:..|.||||||||||.:.:|||||..|||:|||:.:     :.||.::.......
 Frog   173 FNDCFVKVPRSPEKPGKGSYWTLHPESGNMFENGCYLRRQKRFKCERSKSGEREKKVNKPGDENG 237

  Fly   127 ANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIE 191
            .:.:......||..:..:...|...|...:..|:...:...:...:.||:        ::|.|..
 Frog   238 GSLKETPVGYDDCSSSRSPQAPVNDGGRDSTGSSIHQASGGSPVGLSPTS--------EQAGTAS 294

  Fly   192 SLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFN--LPFNFNEL--AAQYQLYFPSFF------- 245
            .||.  |....|:|.:.:   ..:.|.|:..||:  .||:..:|  :.|.|.| ||..       
 Frog   295 QLMY--PLGLSNDGYLGL---VGEDVHLKHDPFSGRHPFSITQLMSSEQDQTY-PSKLEMCPTTD 353

  Fly   246 -------YNGQYGNI 253
                   |:..|.|:
 Frog   354 HLVHYSNYSSDYHNM 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 57/87 (66%)
Alpha_kinase 106..>194 CDD:295997 14/92 (15%)
foxa4NP_988938.1 Forkhead_N <25..118 CDD:369872 3/9 (33%)
COG5025 <118..303 CDD:227358 78/194 (40%)
FH 119..207 CDD:214627 57/87 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..290 9/78 (12%)
HNF_C 326..387 CDD:370449 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.