DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxl1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:238 Identity:92/238 - (38%)
Similarity:125/238 - (52%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            ||||||||:|.||||.::|.:...||.||:||||:||:|..|.|.||||:|||||.|||||||||
Zfish    51 QKPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPR 115

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFR--------VKQLEKDISNWKLAAAANTEMVT 133
            ...:.||||||||.....||||||:..||:::.|        |......::::||...|.:|.|:
Zfish   116 EKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTRVTSFKLHQGAQSEKVS 180

  Fly   134 HYLDDQLTQMAFAD---------PARHGHVLANASAAQMSPYKATPPILPTTVTQLP--ARPKRA 187
                 .|.|....|         |......:|:.||.......:      ||:..||  ..|:|:
Zfish   181 -----PLKQNPGRDIKEKSNDTQPQNEEENVASESAKDWCLASS------TTIVSLPRCTTPERS 234

  Fly   188 FTIESLM--APDPASTPNEGLVPMEYG-----SPDAVALEKPP 223
            .|:.::.  ...|.|:.:|..||::..     |.||.:.|..|
Zfish   235 STVSTVAVNTHTPLSSASETRVPVKSDTGRAQSGDAKSKESNP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 57/87 (66%)
Alpha_kinase 106..>194 CDD:295997 21/106 (20%)
foxl1NP_957278.1 FH 52..140 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.