DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and bin

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster


Alignment Length:329 Identity:84/329 - (25%)
Similarity:127/329 - (38%) Gaps:79/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            :||..|||::...||..||...|.|||||.::...:.|:|.....|:||:|||||.|:||.|:|:
  Fly   310 EKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPK 374

  Fly    77 --NVTKAGKGSYWTLHPMAFDMFEN-GSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDD 138
              .|.|.|||:|||:...:..:||: |||.||.:.:|.|     |.....|..||....:.|.|.
  Fly   375 GMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSK-----IKVKPYAGHANGYYASGYGDA 434

  Fly   139 QLTQ---------------------------MAFADP----ARHG------------------HV 154
            .:..                           ..||||    |.|.                  ::
  Fly   435 GMDNGNYYASPAFASYDYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNI 499

  Fly   155 LANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEY------GS 213
            ...|:...::....|||:..:.:...|:....:..:.:.........|...||...|      ||
  Fly   500 SCLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGS 564

  Fly   214 PD----AVALEKPPFNLPFNFNELAAQYQLY---------FPSFFYNG---QYGNIPCYQKTPPL 262
            .|    :::|::.|........:..||.|.:         .||..:.|   .:.|......|||.
  Fly   565 LDNGLRSISLQQLPGLSSIQHAQAQAQAQAHHHHHQHHASHPSHSHQGHGSMHQNHGTSSTTPPP 629

  Fly   263 FHNG 266
            ..:|
  Fly   630 SQSG 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 40/90 (44%)
Alpha_kinase 106..>194 CDD:295997 19/136 (14%)
binNP_523950.2 Forkhead 311..399 CDD:278670 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.