DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxi2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_944598.2 Gene:foxi2 / 387256 ZFINID:ZDB-GENE-031126-2 Length:383 Species:Danio rerio


Alignment Length:265 Identity:89/265 - (33%)
Similarity:123/265 - (46%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|||||.:|.||||.::.::.|.||:||:::.|.||||:|:...||||:|||||.||||.||||:
Zfish   129 RPPYSYSALIAMAIQNAHEKKLTLSQIYQYVADNFPFYKKSKAGWQNSIRHNLSLNDCFKKVPRD 193

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||||.|....||:||:..|:|||      ..|.|.   ..::||:..    ||:  |
Zfish   194 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR------RSDSST---GVSSNTKPE----DDR--Q 243

  Fly   143 MAFADPARHGHVLANASA---AQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTPNE 204
            :|...|....|:...||.   |....:|...|      ..|.:.|.......|:.|...:|||..
Zfish   244 LAGIKPTDSPHLTGPASPDADAATDSHKGASP------AGLASAPCFNNFFNSMSALGSSSTPTS 302

  Fly   205 -----GLV-------------------PMEYGSP---DAVALEKPPFNLPFNFNELAAQYQLYFP 242
                 |||                   |...|:|   |:|.:.:..:     :|.........|.
Zfish   303 RHGSLGLVNELSSRNISALSPYHASTGPEAGGAPELQDSVHVNRGMY-----YNSFTGGQSTQFN 362

  Fly   243 SFFYN 247
            ..|||
Zfish   363 GHFYN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 21/90 (23%)
foxi2NP_944598.2 Forkhead 129..215 CDD:278670 48/85 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.